PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000260.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 433aa    MW: 49686.6 Da    PI: 9.359
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000260.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.45.3e-27301350352
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              ++i ledl+kyF+lpi++A+k+L+v+lTvLK++CR++GI+RWPhRkiksl
  Itr_sc000260.1_g00008.1 301 ARIALEDLAKYFDLPITEASKSLKVGLTVLKKKCREFGIPRWPHRKIKSL 350
                              689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.668286370IPR003035RWP-RK domain
PfamPF020422.5E-22303350IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MAPAQTRVLR ALVVYINSMY KEMFRAVRVY RISGGSEEET EEKEYVLSSN RKDKRFGENG  60
GSRVLTLYGF DVAEQRAGVN NGVWKCVYVF DSLRSQSPVV DFCDEWIPIS HPGAEVWARK  120
EKTPLISMLS EHVFCTEPYF GRARTWYNDG NANRLFPSGV ELFGYDGDAN ETKTMRHNVV  180
SFRVQGLVNG EQSPFYAKLR ICIGCNVWSA TKAKRKDVLV FQDLVNDLHT ISKLARSAET  240
TDSEQSLLTE ACSSKNSSKH PMEMTTSVRF LDLNSIPDSD ADENNVISEP KKRRAAPEDI  300
ARIALEDLAK YFDLPITEAS KSLKVGLTVL KKKCREFGIP RWPHRKIKSL DRLISNLQEE  360
MQQQQEEDEA TAMAVSKKKR MIEFEKKRIE KKPSMDIREE TKKFRQDVFK RKHKARILER  420
ESQNRNNATL SLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766399.16e-71PREDICTED: protein RKD5 isoform X1
TrEMBLA0A068U0G84e-71A0A068U0G8_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1442579
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.17e-44RWP-RK domain-containing protein